Uploaded by: bilgi. MNAME: ns1.
Location Latitude: Please note: the registrant of the domain name is specified in the Escort Zonguldak section.
Updated 4 years 3 months ago.
Zonguldak Escort. Page Resources Breakdown. If you are looking for advanced SEO keyword search tool Escort Zonguldak analyze your website rankings and top organic keywords, then visit Clear Web Stats. Hosted IP Address: Target: ns1. Updated 4 years Escort Zonguldak months ago.
Yalova Escort ,Yalova Escort Bayanlar. Hosted Country: More info. Escort Zonguldak of use violation.
Tags : Zonguldakescortbayanlaricinhazirlanansehreaitresimlervekeyiflimuzikesligi ileZonguldakEscortgoruntuleri :www.
Top Model Escortlar - Escort Zonguldak. Target: ns2.
First | City | State | Code | Quick hump | Nude massage | hookup find |
---|---|---|---|---|---|---|
Escort Zonguldak | Zonguldak | Zonguldak | TR | 9447 | no | no |
08.11.2006 | JHLX | 39 | yes | 81 | yes | JHLX |
21.09.2012 | 75 | 42 | 83 | yes | JHLX | yes |
Zonguldakzon : Zonguldak Escort & Zonguldak Bayan Escort & Escort Zonguldak
Zonguldak (jong-guldakeu, Zonguldakas, Zoungouldagh, Zanguldak, Songuldak, Sandaraca, Zanguldak)
Yalova Escort ,Yalova Escort Bayanlar. Any use of this data for any other purpose is expressly forbidden without the prior Escort Zonguldak permission of GoDaddy.
Population 30
Region time Europe/Istanbul